Anti-Brain Natriuretic Peptide, aa1-32 (BNP)

Anti-Brain Natriuretic Peptide, aa1-32 (BNP)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
B2702-33B.10 10 µg - -

3 - 19 business days*

517.00€
B2702-33B.100 100 µg - -

3 - 19 business days*

1,071.00€
 
Human brain natriuretic peptide (BNP) is a secreted protein which is a member of the natriuretic... more
Product information "Anti-Brain Natriuretic Peptide, aa1-32 (BNP)"
Human brain natriuretic peptide (BNP) is a secreted protein which is a member of the natriuretic peptide family. BNP is a cardiac hormone, which is synthesized as a pro-hormone (proBNP), and is proteolytically cleaved to release a biologically active fragment (BNP), and an inactive fragment (NT-proBNP) into the circulation. , , BNP is predominantly secreted from the cardiac ventricles in response to volume and pressure overload, and results in a number of biological activities including natriuresis, diuresis, vasorelaxation, and inhibition of the sympathetic nervous system. A high concentration of BNP in the bloodstream is indicative of heart failure. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Anti-NPPB, Anti-BNP-32, Anti-BNP(3-29), Anti-BNP(5-29), Anti-BNP(3-32), Anti-BNP(4-31), Anti-BNP(1-30), Anti-BNP(1-29), Anti-BNP(3-30), Anti-BNP(2-31), Anti-BNP(1-28), Anti-BNP(5-32), Anti-BNP(5-31), Anti-BNP(4-29), Anti-BNP(4-30), Anti-BNP(1-32)
Supplier: United States Biological
Supplier-Nr: B2702-33B

Properties

Application: ELISA
Antibody Type: Monoclonal
Clone: 7-13
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH)
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Brain Natriuretic Peptide, aa1-32 (BNP)"
Write a review
or to review a product.
Viewed