Anti-BMX (Cytoplasmic Tyrosine-protein Kinase BMX, Bone Marrow Tyrosine Kinase Gene in Chromosome X

Anti-BMX (Cytoplasmic Tyrosine-protein Kinase BMX, Bone Marrow Tyrosine Kinase Gene in Chromosome X
Item number Size Datasheet Manual SDS Delivery time Quantity Price
123968.100 100 µg - -

3 - 19 business days*

715.00€
 
Etk is a member of the Bruton's tyrosine kinase family. Etk is expressed in a variety of... more
Product information "Anti-BMX (Cytoplasmic Tyrosine-protein Kinase BMX, Bone Marrow Tyrosine Kinase Gene in Chromosome X"
Etk is a member of the Bruton's tyrosine kinase family. Etk is expressed in a variety of hematopoietic, epithelial and endothelial cells. It participates in multiple signal transduction pathways. Phosphorylation of tyrosine 566 by Src kinase is required for activation of Etk in vivo. In endothelial and epithelial cells, Etk is regulated by FAK through phosphorylation at tyrosine 40. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 123968

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 3G3
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa150-280 from human BMX (AAH16652) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-BMX (Cytoplasmic Tyrosine-protein Kinase BMX, Bone Marrow Tyrosine Kinase Gene in Chromosome X"
Write a review
or to review a product.
Viewed