Anti-BMPER / Crossveinless 2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG42660.50	50 µl		-	-	10 - 15 business days*		584.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Inhibitor of bone morphogenetic protein (BMP) function, it may regulate BMP... more

Close menu

Product information "Anti-BMPER / Crossveinless 2"

Protein function: Inhibitor of bone morphogenetic protein (BMP) function, it may regulate BMP responsiveness of osteoblasts and chondrocytes. [The UniProt Consortium]

Keywords:	Anti-hCV2, Anti-BMPER, Anti-KIAA1965, Anti-Protein crossveinless-2, Anti-BMP-binding endothelial regulator protein, Anti-Bone morphogenetic protein-binding endothelial cell precursor-derived regulator
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG42660

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, cow, dog, guinea pig, horse, swine, rabbit)
Immunogen:	Synthetic peptide around the C-terminal region of Human BMPER / Crossveinless 2. (Within the following region: NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV)
MW:	76 kD
Format:	Affinity Purified