Anti-BMP4

Anti-BMP4
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31950 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Bone morphogenetic protein 4 is a protein... more
Product information "Anti-BMP4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Bone morphogenetic protein 4 is a protein that in humans is encoded by the BMP4 gene. It is found on chromosome 14q22-q23. The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein. Protein function: Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. [The UniProt Consortium]
Keywords: Anti-BMP4, Anti-BMP2B, Anti-BMP-4, Anti-BMP-2B, Anti-Bone morphogenetic protein 4, Anti-Bone morphogenetic protein 2B, BMP4 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31950

Properties

Application: WB, ELISA
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Amino acids SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND of human BMP4 were used as the immunogen for the BMP4 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-BMP4"
Write a review
or to review a product.
Anti-BMP4 Anti-BMP4
754.00€ *
Anti-BMP-4 Anti-BMP-4
707.00€ *
Anti-BMP4 Anti-BMP4
From 361.00€ *
Anti-BMP4 Anti-BMP4
From 89.00€ *
Anti-BMP4 Anti-BMP4
From 89.00€ *
Viewed