Anti-BDKRB2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-R32515	100 µg		-	-	7 - 12 business days*		790.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Bradykinin receptor B2 is a G-protein... more

Close menu

Product information "Anti-BDKRB2"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

Keywords:	Anti-B2R, Anti-BKR2, Anti-BDKRB2, Anti-BK-2 receptor, Anti-B2 bradykinin receptor, BDKRB2 Antibody
Supplier:	NSJ Bioreagents
Supplier-Nr:	R32515

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Amino acids 357-391 (RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ) from the human protein
Format:	Purified