Anti-BD1, aa1-36 (beta Defensin-1)

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
B0899-03G.10	10 µg		-	-	3 - 19 business days*		413.00€
B0899-03G.100	100 µg		-	-	3 - 19 business days*		941.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Applications: |Suitable for use in ELISA and Western Blot. Other applications not... more

Close menu

Product information "Anti-BD1, aa1-36 (beta Defensin-1)"

Applications: , Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Western Blotting: 1:1000-1:2000, Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Keywords:	Anti-BD-1, Anti-DEFB1, Anti-hBD-1, Anti-Beta-defensin 1, Anti-Defensin, beta 1
Supplier:	United States Biological
Supplier-Nr:	B0899-03G

Properties

Application:	ELISA, WB
Antibody Type:	Monoclonal
Clone:	M4-14b-H4
Conjugate:	No
Host:	Mouse
Species reactivity:	human
Immunogen:	Synthetic human -Defensin 1 (aa 1-36) (3 disulfide bridges) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK)
Format:	Affinity Purified