Anti-BCL2L10 (Bcl-2-like Protein 10, Bcl2-L-10, Anti-apoptotic Protein NrH, Apoptosis Regulator Bcl-

Anti-BCL2L10 (Bcl-2-like Protein 10, Bcl2-L-10, Anti-apoptotic Protein NrH, Apoptosis Regulator Bcl-
Item number Size Datasheet Manual SDS Delivery time Quantity Price
123884.100 100 µg - -

3 - 19 business days*

715.00€
 
Bcl-B (also called Bcl2-L-10) is a novel anti-apoptotic member of the Bcl-2 family. Bcl-B is... more
Product information "Anti-BCL2L10 (Bcl-2-like Protein 10, Bcl2-L-10, Anti-apoptotic Protein NrH, Apoptosis Regulator Bcl-"
Bcl-B (also called Bcl2-L-10) is a novel anti-apoptotic member of the Bcl-2 family. Bcl-B is closest in aa sequence homology to Boo protein. It contains four Bcl-2 homologs. Bcl-B mRNA is widely expressed in adult human tissues. The Bcl-B protein binds to Bcl-2, Bcl-X(L), and Bax but not Bak. Bcl-B suppresses apoptosis induced by Bax, but not by Bak. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 123884

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 1B11
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa1-92 from BCL2L10 (NP_065129) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-BCL2L10 (Bcl-2-like Protein 10, Bcl2-L-10, Anti-apoptotic Protein NrH, Apoptosis Regulator Bcl-"
Write a review
or to review a product.
Viewed