Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| 123867.100 | 100 µg | - | - |
5 - 10 business days* |
850.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
In breast cancer, the antiestrogen tamoxifen has been prescribed for both primary treatment and... more
Product information "Anti-BCAR3 (Breast Cancer Anti-estrogen Resistance Protein 3, Novel SH2-containing Protein 2, SH2 Do"
In breast cancer, the antiestrogen tamoxifen has been prescribed for both primary treatment and the treatment of advanced metastatic disease. Although the drug induces remission in most patients with estrogen receptor-positive disease, all patients eventually develop resistance. van Agthoven et al. (1998) applied an insertional mutagenesis strategy to a breast cancer cell line. Infected cells were subjected to tamoxifen selection, and the resistant clones were screened for a common integration site linked with antiestrogen resistance. By screening a human testis cDNA library with the integration site-specific probe, they obtained a cDNA encoding BCAR3 (breast cancer antiestrogen resistance 3). The deduced 825aa BCAR3 protein contains a putative Src homology 2 (SH2) domain and sequences homologous to yeast CDC48. Northern blot analysis detected abundant expression of a 3.4kb BCAR3 transcript in heart, placenta, skeletal muscle, spleen, prostate, testis, ovary, small intestine, colon, fetal kidney, and several cancer cell lines, but not in nonmalignant breast tissue, a 6kb BCAR3 transcript was also detected in skeletal muscle and heart. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
| Supplier: | United States Biological |
| Supplier-Nr: | 123867 |
Properties
| Application: | ELISA, WB |
| Antibody Type: | Monoclonal |
| Clone: | 3G4 |
| Conjugate: | No |
| Host: | Mouse |
| Species reactivity: | human |
| Format: | Affinity Purified |
Database Information
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed