Anti-ATP11C

Anti-ATP11C
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ6040 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ATP11C is an enzyme that in humans is... more
Product information "Anti-ATP11C"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ATP11C is an enzyme that in humans is encoded by the ATP11C gene. This gene is mapped to Xq27.1. Protein function: Catalytic component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. In the cell membrane of erythrocytes, it is required to maintain phosphatidylserine (PS) in the inner leaflet preventing its exposure on the surface. This asymmetric distribution is critical for the survival of erythrocytes in circulation since externalized PS is a phagocytic signal for splenic macrophages (PubMed:26944472). Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules. Required for B cell differentiation past the pro-B cell stage. Seems to mediate PS flipping in pro-B cells. May be involved in the transport of cholestatic bile acids. [The UniProt Consortium]
Keywords: Anti-ATPIG, Anti-ATP11C, Anti-ATPase IQ, EC=7.6.2.1, Anti-ATPase class VI type 11C, Anti-Phospholipid-transporting ATPase IG, Anti-P4-ATPase flippase complex alpha subunit ATP11C, ATP11C Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ6040

Properties

Application: WB, IF, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids QNHEIELTKVHVERNAMDGYRTLCVAFKEIAPDDYER from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ATP11C"
Write a review
or to review a product.
Viewed