Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-R32923 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein atonal homolog 1 is a protein that... more
Product information "Anti-ATOH1 / MATH1 (N-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells). Protein function: Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription. [The UniProt Consortium]
| Keywords: | Anti-ATH1, Anti-hATH1, Anti-bHLHa14, Anti-Protein atonal homolog 1, Anti-Transcription factor ATOH1, Anti-Helix-loop-helix protein hATH-1, Anti-Atonal bHLH transcription factor 1, Anti-Class A basic helix-loop-helix protein 14, ATOH1 Antibody / MATH1 (N-T |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | R32923 |
Properties
| Application: | WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, rat |
| Immunogen: | Amino acids 1-30 (MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ) |
| Format: | Gene Regulation |
Database Information
| KEGG ID : | K09083 | Matching products |
| UniProt ID : | Q92858 | Matching products |
| Gene ID : | GeneID 474 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed