Anti-ATOH1 / MATH1 (N-Terminal Region)

Anti-ATOH1 / MATH1 (N-Terminal Region)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32923 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein atonal homolog 1 is a protein that... more
Product information "Anti-ATOH1 / MATH1 (N-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells). Protein function: Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription. [The UniProt Consortium]
Keywords: Anti-ATH1, Anti-hATH1, Anti-bHLHa14, Anti-Protein atonal homolog 1, Anti-Transcription factor ATOH1, Anti-Helix-loop-helix protein hATH-1, Anti-Atonal bHLH transcription factor 1, Anti-Class A basic helix-loop-helix protein 14, ATOH1 Antibody / MATH1 (N-T
Supplier: NSJ Bioreagents
Supplier-Nr: R32923

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids 1-30 (MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ)
Format: Gene Regulation

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ATOH1 / MATH1 (N-Terminal Region)"
Write a review
or to review a product.
Viewed