Anti-ASXL1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59431.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Probable Polycomb group (PcG) protein involved in transcriptional regulation... more

Close menu

Product information "Anti-ASXL1"

Protein function: Probable Polycomb group (PcG) protein involved in transcriptional regulation mediated by ligand-bound nuclear hormone receptors, such as retinoic acid receptors (RARs) and peroxisome proliferator-activated receptor gamma (PPARG). Acts as coactivator of RARA and RXRA through association with NCOA1. Acts as corepressor for PPARG and suppresses its adipocyte differentiation-inducing activity. Non-catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1). [The UniProt Consortium]

Keywords:	Anti-ASXL1, Anti-KIAA0978, Anti-Additional sex combs-like protein 1, Anti-Putative Polycomb group protein ASXL1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59431

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse (Expected: rat)
Immunogen:	Synthetic peptide corresponding to a sequence of Human ASXL1. (KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE)
MW:	165 kD
Format:	Antigen Affinity Purified