Anti-ASPH / Aspartate Beta Hydroxylase

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58312.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Isoform 1: specifically hydroxylates an Asp or Asn residue in certain epidermal... more

Close menu

Product information "Anti-ASPH / Aspartate Beta Hydroxylase"

Protein function: Isoform 1: specifically hydroxylates an Asp or Asn residue in certain epidermal growth factor-like (EGF) domains of a number of proteins. [The UniProt Consortium]

Keywords:	Anti-BAH, Anti-ASPH, Anti-ASP beta-hydroxylase, Anti-Aspartate beta-hydroxylase, Anti-Peptide-aspartate beta-dioxygenase, Anti-Aspartyl/asparaginyl beta-hydroxylase
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58312

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat (Expected: hamster)
Immunogen:	Synthetic peptide corresponding to a sequence at the C-terminus of Human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related Mouse sequence
MW:	86 kD
Format:	Antigen Affinity Purified