Anti-ASIC2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58220.50	50 µg		-	-	6 - 14 business days*		508.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Cation channel with high affinity for sodium, which is gated by extracellular... more

Close menu

Product information "Anti-ASIC2"

Protein function: Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate. [The UniProt Consortium]

Keywords:	Anti-MDEG, Anti-BNC1, Anti-ACCN, Anti-ASIC2, Anti-BNaC1, Anti-Brain sodium channel 1, Anti-Acid-sensing ion channel 2, Anti-Mammalian degenerin homolog, Anti-Amiloride-sensitive brain sodium channel, Anti-Amiloride-sensitive cation channel neuronal 1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58220

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat
Immunogen:	Synthetic peptide corresponding to aa. 112-147 of Human ACCN1. (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK)
MW:	58 kD
Format:	Antigen Affinity Purified