Anti-ARHGDIA (Rho GDP-dissociation Inhibitor 1, Rho GDI 1, Rho-GDI alpha, GDIA1)

Anti-ARHGDIA (Rho GDP-dissociation Inhibitor 1, Rho GDI 1, Rho-GDI alpha, GDIA1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
123495.100 100 µg - -

3 - 19 business days*

699.00€
 
Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP... more
Product information "Anti-ARHGDIA (Rho GDP-dissociation Inhibitor 1, Rho GDI 1, Rho-GDI alpha, GDIA1)"
Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 123495

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 1G5-2F3
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Full length recombinant corresponding to aa1-204 from human ARHGDIA (AAH16031) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ARHGDIA (Rho GDP-dissociation Inhibitor 1, Rho GDI 1, Rho-GDI alpha, GDIA1)"
Write a review
or to review a product.
Viewed