Anti-ARF5 (ADP-ribosylation Factor 5)

Anti-ARF5 (ADP-ribosylation Factor 5)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
123464.100 100 µg - -

3 - 19 business days*

850.00€
 
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic... more
Product information "Anti-ARF5 (ADP-ribosylation Factor 5)"
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking, may modulate vesicle budding and uncoating within the Golgi apparatus. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 15ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 123464

Properties

Application: ELISA, IF, WB
Antibody Type: Monoclonal
Clone: 1B4
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat
Immunogen: Partial recombinant corresponding to aa81-180 from human ARF5 (AAH03043) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ARF5 (ADP-ribosylation Factor 5)"
Write a review
or to review a product.
Viewed