Anti-ARC / Activity-regulated cytoskeleton-associated protein

Anti-ARC / Activity-regulated cytoskeleton-associated protein
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32271 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Arc is widely considered to be an... more
Product information "Anti-ARC / Activity-regulated cytoskeleton-associated protein"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience. Protein function: Required for consolidation of synaptic plasticity as well as formation of long-term memory. Regulates endocytosis of AMPA receptors in response to synaptic activity. Required for homeostatic synaptic scaling of AMPA receptors. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. [The UniProt Consortium]
Keywords: Anti-Arg3.1, Anti-ARC/ARG3.1, Anti-Activity-regulated gene 3.1 protein homolog, Anti-Activity-regulated cytoskeleton-associated protein, ARC Antibody / Activity-regulated cytoskeleton-associated protein
Supplier: NSJ Bioreagents
Supplier-Nr: R32271

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ARC / Activity-regulated cytoskeleton-associated protein"
Write a review
or to review a product.
Viewed