Anti-AQP5 / Aquaporin 5

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4537 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aquaporin 5, also known as AQP5, is a... more
Product information "Anti-AQP5 / Aquaporin 5"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aquaporin 5, also known as AQP5, is a water channel protein. The aquaporins (AQPs) are a family of more than 10 homologous water transporting proteins expressed in many mammalian epithelia and endothelia. At least five AQPs are expressed in the eye: AQP0 (MIP) in lens fiber, AQP1 in cornea endothelium, ciliary and lens epithelia and trabecular meshwork, AQP3 in conjunctiva, AQP4 in ciliary epithelium and retinal M?ller cells, and AQP5 in corneal and lacrimal gland epithelia. Among the seven human aquaporins cloned to date (AQPs 0-6), genes encoding the four most closely related aquaporins (AQP0, AQP2, AQP5, and AQP6) have been mapped to chromosome band 12q13, suggesting an aquaporin family gene cluster at this locus. Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions. Protein function: Forms a water-specific channel. Implicated in the generation of saliva, tears, and pulmonary secretions. Required for TRPV4 activation by hypotonicity (PubMed:16571723). Together with TRPV4, controls regulatory volume decrease in salivary epithelial cells (PubMed:16571723). [The UniProt Consortium]
Keywords: Anti-AQP5, Anti-AQP-5, Anti-Aquaporin-5, AQP5 Antibody / Aquaporin 5
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4537

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids NSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-AQP5 / Aquaporin 5"
Write a review
or to review a product.
Viewed