Anti-AQP1 / Aquaporin 1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32050 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aquaporin 1 is a 28-kD integral protein... more
Product information "Anti-AQP1 / Aquaporin 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Protein function: Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient (PubMed:1373524). Component of the ankyrin-1 complex, a multiprotein complex involved in the stability and shape of the erythrocyte membrane (PubMed:35835865). [The UniProt Consortium]
Keywords: Anti-AQP-1, Anti-CHIP28, Anti-Aquaporin-1, Anti-Aquaporin-CHIP, Anti-Urine water channel, Anti-Water channel protein for red blood cells and kidney proximal tubule, AQP1 Antibody / Aquaporin 1
Supplier: NSJ Bioreagents
Supplier-Nr: R32050

Properties

Application: WB, IHC (paraffin), IF, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids DRVKVWTSGQVEEYDLDADDINSRVEMKPK of human Aquaporin 1
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-AQP1 / Aquaporin 1"
Write a review
or to review a product.
Viewed