Anti-Apolipoprotein AI (Apo AI, ApoA-I, Apolipoprotein A1, APOA1)

Anti-Apolipoprotein AI (Apo AI, ApoA-I, Apolipoprotein A1, APOA1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
123442.50 50 µg - -

3 - 19 business days*

850.00€
 
Apolipoprotein AI promotes cholesterol efflux from tissues to the liver for excretion.... more
Product information "Anti-Apolipoprotein AI (Apo AI, ApoA-I, Apolipoprotein A1, APOA1)"
Apolipoprotein AI promotes cholesterol efflux from tissues to the liver for excretion. Apolipoprotein AI is the major protein component of high density lipoprotein (HDL) in the plasma. Synthesized in the liver and small intestine, it consists of two identical chains of 77aa, an 18aa signal peptide is removed co-translationally and a 6aa propeptide is cleaved post-translationally. Apolipoprotein A I is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. Defects in the Apolipoprotein A I gene are associated with HDL deficiency and Tangier disease. The therapeutic potential of apoA-I has been recently assessed in patients with acute coronary syndromes, using a recombinant form of a naturally occurring variant of apoA-I. The availability of recombinant normal apoA-I should facilitate further investigation into the potential usefulness of apoA-I in preventing atherosclerotic vascular diseases. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 123442

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Apolipoprotein AI (Apo AI, ApoA-I, Apolipoprotein A1, APOA1)"
Write a review
or to review a product.
Viewed