Anti-APEX1 (DNA-(Apurinic or Apyrimidinic Site) Lyase, APEX Nuclease, APEN, Apurinic-apyrimidinic En

Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene, all encode the same protein. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: ELISA (Sandwich): Detection limit is ~3ng/ml using 123398 as a capture antibody., Optimal dilutions to be determined by the researcher. AA Sequence: DLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.