Anti-APC2

Anti-APC2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32509 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. APC2, also called APCL or Adenomatous... more
Product information "Anti-APC2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. APC2, also called APCL or Adenomatous polyposis coli protein-like, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC. Protein function: Stabilizes microtubules and may regulate actin fiber dynamics through the activation of Rho family GTPases (PubMed:25753423). May also function in Wnt signaling by promoting the rapid degradation of CTNNB1 (PubMed:10021369, PubMed:11691822, PubMed:9823329). [The UniProt Consortium]
Keywords: Anti-APC2, Anti-APCL, Anti-APC-like, Anti-Adenomatous polyposis coli protein 2, Anti-Adenomatous polyposis coli protein-like, APC2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32509

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 51-90 (KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-APC2"
Write a review
or to review a product.
Viewed