Anti-ANGPTL4

Anti-ANGPTL4
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32788 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Angiopoietin-related protein 4 (Angptl4)... more
Product information "Anti-ANGPTL4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Angiopoietin-related protein 4 (Angptl4) is a protein that in humans is encoded by the ANGPTL4 gene. This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. And this gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. By radiation hybrid analysis, Angptl4 gene is mapped to 19p13.3. ANGPTL4 contributed to tumor growth and protected cells from anoikis, a form of programmed cell death induced when contact-dependent cells detach from the surrounding tissue matrix. Protein function: Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism (PubMed:19270337, PubMed:21398697, PubMed:27929370, PubMed:29899144). May also play a role in regulating glucose homeostasis and insulin sensitivity (Probable). Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage (PubMed:14583458, PubMed:17068295). Upon heterologous expression, inhibits the adhesion of endothelial cell to the extracellular matrix (ECM), and inhibits the reorganization of the actin cytoskeleton, formation of actin stress fibers and focal adhesions in endothelial cells that have adhered to ANGPTL4-containing ECM (in vitro) (PubMed:17068295). Depending on context, may modulate tumor-related angiogenesis. [The UniProt Consortium]
Keywords: Anti-ARP4, Anti-ANGPTL4, ANGPTL4 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32788

Properties

Application: WB, IHC (paraffin), ELISA
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 369-406 (QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ANGPTL4"
Write a review
or to review a product.
Viewed