Anti-Androgen Receptor (Dihydrotestosterone Receptor, Nuclear Receptor Subfamily 3 Group C Member 4,

The Androgen Receptor (AR) is a 90kD steroid hormone receptor that is critical for the development and function of the male reproductive system. AR binding to testosterone or 5a-dihydrotestosterone (DHT) triggers receptor dimerization followed by translocation to the nucleus where it promotes transcription of androgen responsive genes. Multiple polymorphisms in AR are linked to the development of prostate cancer. The ligand binding domain of human AR aa661-920 shares aa sequence identity with mouse and rat AR. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: SKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.