Anti-AMPK beta 2 / PRKAB2, clone 6G1

Anti-AMPK beta 2 / PRKAB2, clone 6G1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4500 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 5'-AMP-activated protein kinase subunit... more
Product information "Anti-AMPK beta 2 / PRKAB2, clone 6G1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene. Protein function: Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton, probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3). [The UniProt Consortium]
Keywords: Anti-PRKAB2, Anti-AMPK subunit beta-2, Anti-5'-AMP-activated protein kinase subunit beta-2, AMPK beta 2 Antibody / PRKAB2
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4500

Properties

Application: WB, FC
Antibody Type: Monoclonal
Clone: 6G1
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Amino acids DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-AMPK beta 2 / PRKAB2, clone 6G1"
Write a review
or to review a product.
Viewed