Anti-AMH, clone 5/6

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG22461.250	250 µl		-	-	6 - 14 business days*		576.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: This glycoprotein, produced by the Sertoli cells of the testis, causes... more

Close menu

Product information "Anti-AMH, clone 5/6"

Protein function: This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. [The UniProt Consortium]

Keywords:	Anti-AMH, Anti-MIF, Anti-MIS, Anti-Anti-Muellerian hormone, Anti-Muellerian-inhibiting factor, Anti-Muellerian-inhibiting substance
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG22461

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Monoclonal
Clone:	5/6
Conjugate:	No
Host:	Mouse
Species reactivity:	human, mouse, sheep, monkey, baboon
Immunogen:	Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
Format:	Purified