Anti-AMACR / p504S

Anti-AMACR / p504S
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40208.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Racemization of 2-methyl-branched fatty acid CoA esters. Responsible for the... more
Product information "Anti-AMACR / p504S"
Protein function: Racemization of 2-methyl-branched fatty acid CoA esters. Responsible for the conversion of pristanoyl-CoA and C27-bile acyl-CoAs to their (S)-stereoisomers. [The UniProt Consortium]
Keywords: Anti-AMACR, EC=5.1.99.4, Anti-2-methylacyl-CoA racemase, Anti-Alpha-methylacyl-CoA racemase
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40208

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat (Expected: bovine, horse, monkey)
Immunogen: Synthetic peptide corresponding to aa. 208-246 of Human AMACR / p504S. (RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK)
MW: 42 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-AMACR / p504S"
Write a review
or to review a product.
Viewed