Anti-Alpha Amylase 1

Anti-Alpha Amylase 1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32663 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Amylase is an enzyme that catalyses the... more
Product information "Anti-Alpha Amylase 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
Keywords: Anti-AMY1, Anti-AMY1A, Anti-AMY1B, Anti-AMY1C, Anti-Alpha-amylase 1, Anti-Salivary alpha-amylase, Anti-1,4-alpha-D-glucan glucanohydrolase 1, Alpha Amylase 1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32663

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 20-50 (NTQQGRTSIVHLFEWRWVDIALECERYLAPK) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Alpha Amylase 1"
Write a review
or to review a product.
Viewed