Anti-ALDH7A1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32506 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aldehyde dehydrogenase 7 family, member... more
Product information "Anti-ALDH7A1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aldehyde dehydrogenase 7 family, member A1, also known as ALDH7A1 or antiquitin, is an enzyme that in humans is encoded by the ALDH7A1 gene. The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism andlipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified. Protein function: Multifunctional enzyme mediating important protective effects. Metabolizes betaine aldehyde to betaine, an important cellular osmolyte and methyl donor. Protects cells from oxidative stress by metabolizing a number of lipid peroxidation-derived aldehydes. Involved in lysine catabolism. [The UniProt Consortium]
Keywords: Anti-ATQ1, Anti-ALDH7A1, EC=1.2.1.3, EC=1.2.1.8, EC=1.2.1.31, Anti-Antiquitin-1, Anti-P6c dehydrogenase, Anti-Alpha-AASA dehydrogenase, Anti-Betaine aldehyde dehydrogenase, Anti-Aldehyde dehydrogenase family 7 member A1, ALDH7A1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32506

Properties

Application: WB, IHC (paraffin), IF/ICC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 333-369 (ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ALDH7A1"
Write a review
or to review a product.
Viewed