Anti-ALDH7A1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58306.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Multifunctional enzyme mediating important protective effects. Metabolizes... more

Close menu

Product information "Anti-ALDH7A1"

Protein function: Multifunctional enzyme mediating important protective effects. Metabolizes betaine aldehyde to betaine, an important cellular osmolyte and methyl donor. Protects cells from oxidative stress by metabolizing a number of lipid peroxidation-derived aldehydes. Involved in lysine catabolism. [The UniProt Consortium]

Keywords:	Anti-ATQ1, Anti-ALDH7A1, EC=1.2.1.8, EC=1.2.1.3, EC=1.2.1.31, Anti-Antiquitin-1, Anti-P6c dehydrogenase, Anti-Alpha-AASA dehydrogenase, Anti-Betaine aldehyde dehydrogenase, Anti-Aldehyde dehydrogenase family 7 member A1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58306

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to a sequence at the C-terminus of Human ALDH7A1 (333-369aa ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY), different from the related Mouse sequence by eight amino acids, and from the related Rat sequence by six amino acids
MW:	58 kD
Format:	Antigen Affinity Purified