Anti-AKR1D1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4911 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Human delta(4)-3-oxosteroid... more
Product information "Anti-AKR1D1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Human delta(4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet. Protein function: Catalyzes the stereospecific NADPH-dependent reduction of the C4-C5 double bond of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure to yield an A/B cis-ring junction. This cis-configuration is crucial for bile acid biosynthesis and plays important roles in steroid metabolism. Capable of reducing a broad range of delta-(4)-3-ketosteroids from C18 (such as, 17beta- hydroxyestr-4-en-3-one) to C27 (such as, 7alpha-hydroxycholest-4-en-3- one). [The UniProt Consortium]
Keywords: Anti-AKR1D1, Anti-SRD5B1, Anti-3-oxo-5-beta-steroid 4-dehydrogenase, Anti-Aldo-keto reductase family 1 member D1, Anti-Delta(4)-3-oxosteroid 5-beta-reductase, Anti-Delta(4)-3-ketosteroid 5-beta-reductase, AKR1D1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4911

Properties

Application: WB, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-AKR1D1"
Write a review
or to review a product.
Viewed