Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used

Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-RQ5641 | 100 µg | - | - |
3 - 10 business days* |
772.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Human delta(4)-3-oxosteroid... more
Product information "Anti-AKR1D1, clone 6I4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Human delta(4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet. Protein function: Catalyzes the stereospecific NADPH-dependent reduction of the C4-C5 double bond of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure to yield an A/B cis-ring junction. This cis-configuration is crucial for bile acid biosynthesis and plays important roles in steroid metabolism. Capable of reducing a broad range of delta-(4)-3-ketosteroids from C18 (such as, 17beta- hydroxyestr-4-en-3-one) to C27 (such as, 7alpha-hydroxycholest-4-en-3- one). [The UniProt Consortium]
Keywords: | Anti-SRD5B1, Anti-AKR1D1, Anti-3-oxo-5-beta-steroid 4-dehydrogenase, Anti-Delta(4)-3-oxosteroid 5-beta-reductase, Anti-Aldo-keto reductase family 1 member D1, Anti-Delta(4)-3-ketosteroid 5-beta-reductase, AKR1D1 Antibody |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | RQ5641 |
Properties
Application: | WB, IHC (paraffin), FC |
Antibody Type: | Monoclonal |
Clone: | 6I4 |
Conjugate: | No |
Host: | Mouse |
Species reactivity: | human, mouse, rat |
Immunogen: | Amino acids EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY from the human protein |
Format: | Purified |
Database Information
KEGG ID : | K00251 | Matching products |
UniProt ID : | P51857 | Matching products |
Gene ID : | GeneID 6718 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed