Anti-AGO2 / Argonaute 2

Anti-AGO2 / Argonaute 2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59343.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Required for RNA-mediated gene silencing (RNAi) by the RNA-induced silencing... more
Product information "Anti-AGO2 / Argonaute 2"
Protein function: Required for RNA-mediated gene silencing (RNAi) by the RNA-induced silencing complex (RISC). The 'minimal RISC' appears to include AGO2 bound to a short guide RNA such as a microRNA (miRNA) or short interfering RNA (siRNA). These guide RNAs direct RISC to complementary mRNAs that are targets for RISC-mediated gene silencing. The precise mechanism of gene silencing depends on the degree of complementarity between the miRNA or siRNA and its target. Binding of RISC to a perfectly complementary mRNA generally results in silencing due to endonucleolytic cleavage of the mRNA specifically by AGO2. Binding of RISC to a partially complementary mRNA results in silencing through inhibition of translation, and this is independent of endonuclease activity. May inhibit translation initiation by binding to the 7-methylguanosine cap, thereby preventing the recruitment of the translation initiation factor eIF4-E. May also inhibit translation initiation via interaction with EIF6, which itself binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit. The inhibition of translational initiation leads to the accumulation of the affected mRNA in cytoplasmic processing bodies (P-bodies), where mRNA degradation may subsequently occur. In some cases RISC-mediated translational repression is also observed for miRNAs that perfectly match the 3' untranslated region (3'-UTR). Can also up-regulate the translation of specific mRNAs under certain growth conditions. Binds to the AU element of the 3'-UTR of the TNF (TNF-alpha) mRNA and up-regulates translation under conditions of serum starvation. Also required for transcriptional gene silencing (TGS), in which short RNAs known as antigene RNAs or agRNAs direct the transcriptional repression of complementary promoter regions. [The UniProt Consortium]
Keywords: Anti-PPD, Anti-AGO2, Anti-hAgo2, Anti-EIF2C2, Anti-eIF2C 2, Anti-eIF-2C 2, Anti-Argonaute2, Anti-Protein slicer, Anti-Protein argonaute-2, Anti-PAZ Piwi domain protein, Anti-Argonaute RISC catalytic component 2
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59343

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat (Expected: bovine, dog, hamster, horse, monkey, rabbit)
Immunogen: Synthetic peptide corresponding to aa. 129-169 of Human AGO2 / Argonaute 2. (KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL)
MW: 97 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-AGO2 / Argonaute 2"
Write a review
or to review a product.
Viewed