Anti-ADAM28

Anti-ADAM28
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32798 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Disintegrin and metalloproteinase... more
Product information "Anti-ADAM28"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Disintegrin and metalloproteinase domain-containing protein 28 is an enzyme that in humans is encoded by the ADAM28 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. And this gene is present in a gene cluster with other members of the ADAM family on chromosome 8. Alternative splicing results in multiple transcript variants. Protein function: May play a role in the adhesive and proteolytic events that occur during lymphocyte emigration or may function in ectodomain shedding of lymphocyte surface target proteins, such as FASL and CD40L. May be involved in sperm maturation. [The UniProt Consortium]
Keywords: Anti-MDC-L, Anti-ADAM23, Anti-ADAM28, Anti-eMDC II, Anti-ADAM 28, EC=3.4.24.-, Anti-Disintegrin and metalloproteinase domain-containing protein 28, Anti-Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L, ADAM28 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32798

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 207-248 (EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ADAM28"
Write a review
or to review a product.
Viewed