Anti-ACTN3

Anti-ACTN3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32494 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Alpha-actinin-3, also known as... more
Product information "Anti-ACTN3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants, the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status. Protein function: F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. [The UniProt Consortium]
Keywords: Anti-ACTN3, Anti-Alpha-actinin-3, Anti-F-actin cross-linking protein, Anti-Alpha-actinin skeletal muscle isoform 3, ACTN3 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32494

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 574-617 (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ACTN3"
Write a review
or to review a product.
Viewed