Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-R32458 | 100 µg | - | - |
7 - 12 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aconitase 2, mitochondrial is a protein... more
Product information "Anti-Aconitase 2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aconitase 2, mitochondrial is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification. Protein function: Catalyzes the isomerization of citrate to isocitrate via cis- aconitate. [The UniProt Consortium]
| Keywords: | Anti-ACO2, Anti-Aconitase, Anti-Citrate hydro-lyase, Anti-Aconitate hydratase, mitochondrial, Aconitase 2 Antibody |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | R32458 |
Properties
| Application: | WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
| Immunogen: | Amino acids TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH from the human protein |
| Format: | Purified |
Database Information
| KEGG ID : | K01681 | Matching products |
| UniProt ID : | Q99798 | Matching products |
| Gene ID : | GeneID 50 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed