Anti-ABLIM3

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59278.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF... more

Close menu

Product information "Anti-ABLIM3"

Protein function: May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity. [The UniProt Consortium]

Keywords:	Anti-ABLIM3, Anti-abLIM-3, Anti-KIAA0843, Anti-HMFN1661, Anti-Actin-binding LIM protein 3, Anti-Actin-binding LIM protein family member 3
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59278

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Synthetic peptide around the middle region of Human ABLIM3. (within the following region: PTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSSTPTSYQAPK)
MW:	78 kD
Format:	Affinity Purified