Anti-ABLIM3

Anti-ABLIM3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59278.50 50 µl - -

6 - 14 business days*

551.00€
 
Protein function: May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF... more
Product information "Anti-ABLIM3"
Protein function: May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity. [The UniProt Consortium]
Keywords: Anti-ABLIM3, Anti-abLIM-3, Anti-KIAA0843, Anti-HMFN1661, Anti-Actin-binding LIM protein 3, Anti-Actin-binding LIM protein family member 3
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59278

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Synthetic peptide around the middle region of Human ABLIM3. (within the following region: PTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSSTPTSYQAPK)
MW: 78 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ABLIM3"
Write a review
or to review a product.
Viewed