7 products were found matching "Q9ULD4"!
No results were found for the filter!
BRPF3 (576-701), Human Recombinant Protein
Item number: BPS-31130
Human Bromodomain and PHD finger containing 3, or BRPF3, amino-acids 576 - 701 (GenBank Accession No. NM_015695) with N-terminal GST-tag, MW = 41.2 kDa, expressed in an E. coli expression system.
| Keywords: | Bromodomain and PHD finger-containing protein 3, |
| Application: | Bromodomain binding assays, inhibitor screening, selectivity profiling |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 41.2 kD |
452.00€
*
BRFP3 Inhibitor Screening Assay Kit
Item number: BPS-32608
The BRPF3 Inhibitor Screening Assay Kit is designed to measure the inhibition of BRPF3 binding to its substrate. The kit comes in a convenient AlphaLISA(R) format, with biotinylated histone peptide substrate, assay buffer, detection buffer and purified GST-tagged BRPF3 bromodomain to perform a total of 384 enzyme...
| Keywords: | BRPF3, Bromodomain and PHD finger containing 3, |
| Application: | Bromodomain binding assays, inhibitor screening, selectivity profiling |
1,496.00€
*
BRPF3 TR-FRET Assay Kit
Item number: BPS-32626
The BRPF3 TR-FRET Assay Kit is designed to measure the inhibition of BRPF3 binding to its substrate in a homogeneous 384 reaction format. This FRET-based assay requires no time-consuming washing steps, making it especially suitable for high throughput screening applications. The assay procedure is straightforward...
| Keywords: | Bromodomain and PHD finger-containing protein 3, |
| Application: | Small molecular inhibitor screening, drug discovery, HTS |
| Species reactivity: | human |
1,496.00€
*
Anti-BRPF3
Item number: ATA-HPA022787.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:26620551, PubMed:26677226). Plays a role in DNA replication initiation by directing KAT7/HBO1 specificity...
| Keywords: | Anti-Bromodomain and PHD finger-containing protein 3 |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 335.00€
*
BRPF3, Recombinant, Human, aa576-701, GST-tag...
Item number: 298384.100
Source:, Recombinant protein corresponding to a single bromodomain, aa576-701, from human Bromodomain and PHD finger containing 3, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.2kD, AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI,...
| Keywords: | BRPF3, KIAA1286, Bromodomain and PHD finger-containing protein 3 |
| MW: | 41,2 |
916.00€
*
BRPF3 TR-FRET, BioAssay(TM) Kit (KIAA1286)
Item number: 298383.1
Kit comes in a convenient format with purified BRPF3 protein, ligands, Tb donor, dye-labeled acceptor, assay buffer and microtiter plate to perform 384 reactions. The BRPF3 TR-FRET BioAssay(TM) Kit is designed to measure the inhibition of BRPF3 binding to its substrate in a homogeneous 384 reaction format. This...
| Keywords: | Bromodomain and PHD finger-containing protein 3 |
| Application: | FRET, Assays |
| Species reactivity: | human |
1,856.00€
*
BRPF3 PrEST Antigen
Item number: ATA-APrEST86913.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:26620551, PubMed:26677226). Plays a role in DNA replication initiation by directing KAT7/HBO1 specificity...
| Keywords: | Bromodomain and PHD finger-containing protein 3 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
247.00€
*