15 products were found matching "Q9BYC9"!
No results were found for the filter!
Anti-MRPL20
Item number: E-AB-18777.120
MRPL20 is one of more than 70 protein components of mitochondrial ribosomes that are encoded by the nuclear genome. MRPL20 is a subunit of the 39S mitochondrial ribosome. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA...
| Keywords: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | WB, IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 89.00€
*
Anti-MRPL20
Item number: ATA-HPA047074.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 91% and to rat: 91%
| Keywords: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ICC, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
39S ribosomal protein L20, mitochondrial...
Item number: CSB-EP863153HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 46-149aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: VIRAFVKCTK ARYLKKKNMR TLWINRITAA SQEHGLKYPA LIGNLVKCQV ELNRKVLADL AIYEPKTFKS LAALASRRRH EGFAAALGDG KEPEGIFSRV VQYH. Purity: Greater than 90% as...
| Keywords: | L20mt, MRPL20, MRP-L20, 39S ribosomal protein L20, mitochondrial, Mitochondrial large ribosomal subunit protein bL20m,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 27.8 kD |
From 219.00€
*
Anti-MRPL20
Item number: CSB-PA003291.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 126.00€
*
Anti-MRPL20
Item number: CSB-PA573615.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
284.00€
*
MRPL20, Human mitochondrial ribosomal protein L20, Real...
Item number: VHPS-5835
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | L20mt, MRPL20, MRP-L20, 39S ribosomal protein L20, mitochondrial |
| Application: | RNA quantification |
45.00€
*
MRPL20, Recombinant, Human, aa46-149, His-SUMO-Tag (39S...
Item number: 374269.1
Source:, Recombinant protein corresponding to aa46-149 from human MRPL20, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: VIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH, Storage and Stability: May be stored...
| Keywords: | L20mt, MRPL20, MRP-L20, 39S ribosomal protein L20, mitochondrial, Mitochondrial large ribosomal subunit protein bL20m |
| MW: | 27,8 |
From 603.00€
*
MRPL20 PrEST Antigen
Item number: ATA-APrEST84684.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | L20mt, MRPL20, MRP-L20, 39S ribosomal protein L20, mitochondrial, Mitochondrial large ribosomal subunit protein bL20m |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-MRPL20
Item number: ABD-8C14065.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPL20 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Keywords: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
628.00€
*
MRPL20 (Vector Vector will be determined during the...
Item number: CSB-CL863153HU1.10
Length: 450 Sequence: atggtcttcc tcaccgcgca gctctggctg cggaatcgcg tcaccgaccg ctactttcgg atccaggagg tgctgaagca cgccaggcac ttccggggaa ggaaaaatcg ctgctacagg ttggcggtca gaaccgtgat tcgagccttt gtgaaatgca ccaaagcccg atacctgaag aaaaagaaca tgaggaccct ctggattaat cgaattacag ctgctagcca ggaacatgga ctgaagtatc cagcgctcat...
| Keywords: | L20mt, MRPL20, MRP-L20, 39S ribosomal protein L20, mitochondrial, Mitochondrial large ribosomal subunit protein bL20m |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
MRPL20 (Vector pUC, Accession No. BC059945)
Item number: CSB-CL863153HU2.10
Length: 450 Sequence: atggtcttcc tcaccgcgca gctctggctg cggaatcgcg tcaccgaccg ctactttcgg atccaggagg tgctgaagca cgccaggcac tttcggggaa ggaaaaatcg ctgctacagg ttggcggtca gaaccgtgat tcgagccttt gtgaaatgca ccaaagcccg atacctgaag aaaaagaaca tgaggaccct ctggattaat cgaattacag ctgctagcca ggaacatgga ctgaagtatc cagcgctcat...
| Keywords: | L20mt, MRPL20, MRP-L20, 39S ribosomal protein L20, mitochondrial, Mitochondrial large ribosomal subunit protein bL20m |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
180.00€
*
Anti-MRPL20, HRP conjugated
Item number: CSB-PA863153LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL20. Antigen Species: Human
| Keywords: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*