10 products were found matching "Q9BYC9"!

MRPL20 is one of more than 70 protein components of mitochondrial ribosomes that are encoded by the nuclear genome. MRPL20 is a subunit of the 39S mitochondrial ribosome. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA...

MRPL20 Antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB, IHC applications. MRPL20 Antibody is Polyclonal and is a IgG isotype antibody from Assay Genie.

MRPL20 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB applications. MRPL20 Antibody is a high quality polyclonal antibody for research use only.

MRPL20 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. MRPL20 Antibody is a high quality polyclonal antibody for research use only.

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 91% and to rat: 91%

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Source:, Recombinant protein corresponding to aa46-149 from human MRPL20, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: VIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH, Storage and Stability: May be stored...

Buffer: PBS and 1M Urea, pH 7.4.

Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPL20 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...