- Search results for Q29118
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "Q29118"!
Close filters
Filter by:
No results were found for the filter!
NEW
Item number: CR-C03018-100UG
Sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL ETSCETQSIT FKSFKDSLNK FLFTIPFDCW with polyhistidine tag at the N-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Cytokine that stimulates the growth and...
Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
Application: | Cell culture |
Expressed in: | E.coli |
Origin: | swine |
From 120.00€
*
Item number: ARG70212.20
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
Application: | SDS-PAGE, cell culture |
Origin: | swine |
From 336.00€
*
Item number: E-PKSS000024.5
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL. Sequence: MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK. Fusion tag: N-His Endotoxin: Please contact us for...
Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Recombinant Swine GM-CSF... |
Application: | Active, cell culture |
Expressed in: | E.coli |
Origin: | swine |
MW: | 17.08 kD |
234.00€
*
Item number: RP0940S-025
Produced in Yeast. Amino acid sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL TEETSCETQS ITFKSFKDSL NKFLFTIPFD CWGPVKK (127).
Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
Application: | Bioassays |
Expressed in: | Yeast |
Origin: | swine |
MW: | 14,4 kD |
From 206.00€
*
Item number: ABE-32-6381-100
Source: Escherichia Coli.Sterile Filtered White lyophilized (freeze-dried) powder.GMCSF is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of GMCSF is found extracellularly as a homodimer. GMCSF has been localized to a cluster of related genes...
Application: | FA |
Expressed in: | E.coli |
Origin: | swine |
From 1,259.00€
*
Item number: ABE-32-6382-10
Source: Escherichia Coli.Sterile Filtered colorless solution.The hematopoietic growth factor GM-CSF or granulocyte macrophage colony-stimulating factor, stimulates the development of neutrophils & macrophages, enhance proliferation and development of early erythroid megakaryocytic & eosinophilic progenitor cells....
Application: | FA |
Expressed in: | E.coli |
Origin: | swine |
From 438.00€
*
Item number: ARG82961.96
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
Keywords: | CSF, CSF, CSF2, GM-CSF, GM-CSF, Colony-stimulating factor, Colony-stimulating factor, Granulocyte-macrophage... |
Application: | ELISA |
Species reactivity: | swine |
880.00€
*
Item number: E-PKSS000024.20
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL. Sequence: MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK. Fusion tag: N-His Endotoxin: Please contact us for...
Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Recombinant Swine GM-CSF... |
Application: | Active, Cell culture |
Expressed in: | E.coli |
Origin: | swine |
MW: | 17.08 kD |
588.00€
*