15 products were found matching "Q29118"!
No results were found for the filter!
Pig GM-CSF recombinant protein (Active)
Item number: ARG70212.20
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | SDS-PAGE, cell culture |
| Origin: | swine |
From 432.00€
*
Porcine GM-CSF (Granulocyte Macrophage Colony Stimulating...
Item number: G-AEES05441.480
Porcine GM-CSF (Granulocyte Macrophage Colony Stimulating Factor) Superset Max DIY ELISA Protein Function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes [The Uniprot Consortium]
| Keywords: | CSF2, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | ELISA |
| Species reactivity: | swine |
919.00€
*
GM-CSF, Swine
Item number: CR-C03018-100UG
Sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL ETSCETQSIT FKSFKDSLNK FLFTIPFDCW with polyhistidine tag at the N-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Cytokine that stimulates the growth and...
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | swine |
From 312.00€
*
GM-CSF, swine recombinant (rpoGM-CSF)
Item number: RP0940S-025
Produced in Yeast. Amino acid sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL TEETSCETQS ITFKSFKDSL NKFLFTIPFD CWGPVKK (127).
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | Bioassays |
| Expressed in: | Yeast |
| Origin: | swine |
| MW: | 14,4 kD |
From 233.00€
*
Porcine GM-CSF ELISA kit
Item number: ARG82961.96
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Keywords: | CSF, CSF, CSF2, GM-CSF, GM-CSF, Colony-stimulating factor, Colony-stimulating factor, Granulocyte-macrophage... |
| Application: | ELISA |
| Species reactivity: | swine |
929.00€
*
GM-CSF protein(N-His)(active) (recombinant swine)
Item number: E-PKSS000024.20
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL. Sequence: MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK. Fusion tag: N-His Endotoxin: Please contact us for...
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Recombinant Swine GM-CSF... |
| Application: | Active, Cell culture |
| Expressed in: | E.coli |
| Origin: | swine |
| MW: | 17.08 kD |
435.00€
*
GM-CSF protein(N-His)(active) (recombinant swine)
Item number: E-PKSS000024.5
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL. Sequence: MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK. Fusion tag: N-His Endotoxin: Please contact us for...
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Recombinant Swine GM-CSF... |
| Application: | Active, cell culture |
| Expressed in: | E.coli |
| Origin: | swine |
| MW: | 17.08 kD |
192.00€
*
Porcine GM-CSF (Granulocyte Macrophage Colony Stimulating...
Item number: G-AEFI00782.96
ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from...
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | Sandwich ELISA, Double Antibody |
| Species reactivity: | swine |
698.00€
*
Swine GM-CSF Recombinant Protein (N-His) (active)
Item number: G-RPES6867.5
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Expressed in: | E.coli |
306.00€
*
Porcine GM-CSF Antibody Pair Set
Item number: E-KAB-0622.1
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Porcine GM-CSF Antibody... |
| Application: | ELISA |
| Species reactivity: | swine |
1,093.00€
*
Uncoated Porcine GM-CSF (Granulocyte Macrophage Colony...
Item number: E-UNEL-P0015.1440
Type: Sandwich-ELISA. Detection Range: 1.56-100 pg/mL. Sensitivity: . Tested Sample Types: Serum, plasma. Test principle: Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and...
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | ELISA |
| Species reactivity: | swine |
From 485.00€
*
Swine GM-CSF ELISA
Item number: DIY2245S-003
The Swine GM-CSF ELISA contains capture antibody, standard, and detection antibody for development of a Swine GM-CSF ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for the ELISA...
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | ELISA |
| Species reactivity: | swine |
From 1,098.00€
*