6 products were found matching "P07150"!

No results were found for the filter!
Rat ANXA1 (Annexin A1) ELISA Kit
Rat ANXA1 (Annexin A1) ELISA Kit

Item number: G-AEKE04901.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat ANXA1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat ANXA1. Next,...
Keywords: p35, Anxa1, Annexin I, Annexin-1, Annexin A1, Calpactin-2, Calpactin II, Lipocortin I, Chromobindin-9, Phospholipase A2...
Application: ELISA
Species reactivity: mouse
694.00€ *
Review
Rat ANXA1(Annexin A1) ELISA Kit
Rat ANXA1(Annexin A1) ELISA Kit

Item number: ELK-ELK10814.48

Plays important roles in the innate immune response as effector of glucocorticoid-mediated responses and regulator of the inflammatory process. Has anti-inflammatory activity. Plays a role in glucocorticoid-mediated down-regulation of the early phase of the inflammatory response. Contributes to the adaptive immune...
Keywords: p35, Anxa1, Annexin-1, Annexin I, Annexin A1, Calpactin-2, Calpactin II, Lipocortin I, Chromobindin-9, Phospholipase A2...
Application: ELISA
Species reactivity: rat
From 374.00€ *
Review
Anxa1, Rat In multiple Geneids, Real Time PCR Primer Set
Anxa1, Rat In multiple Geneids, Real Time PCR Primer Set

Item number: VRPS-324

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: p35, Anx1, Anxa1, Annexin-1, Annexin I, Annexin A1, Calpactin-2, Calpactin II, Lipocortin I, Chromobindin-9, Phospholipase...
Application: RNA quantification
54.00€ *
Review
Annexin A1 (ANXA1) Recombinant, Rat
Annexin A1 (ANXA1) Recombinant, Rat

Item number: 153520.10

Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P07150, Fragment: Met1~Asn346 (Accession No: P07150), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-MAMVSEFLKQ ACYIEKQEQE YVQAVKSYKG GPGSAVSPYP SFNPSSDVAA LHKAIMVKGV DEATIIDILT...
From 459.00€ *
Review
Rat ANXA1 (Annexin A1) ELISA Kit
Rat ANXA1 (Annexin A1) ELISA Kit

Item number: G-AEFI00955.96

ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Plays important roles in the innate immune response as effector of glucocorticoid-mediated...
Keywords: Anx1, Anxa1
Application: Sandwich ELISA, Double Antibody
Species reactivity: rat
698.00€ *
Review
Anti-Anxa1
Anti-Anxa1

Item number: CSB-PA001836XA01RA.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Keywords: Anti-p35, Anti-Anx1, Anti-Anxa1, Anti-Annexin-1, Anti-Annexin I, Anti-Annexin A1, Anti-Calpactin-2, Anti-Lipocortin I,...
Application: ELISA, WB
Host: Rabbit
Species reactivity: Rattus norvegicus (Rat)
From 1,529.00€ *
Review