- Search results for P07150
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
4 products were found matching "P07150"!
Close filters
Filter by:
No results were found for the filter!
Item number: ELK-ELK7415.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat ANXA1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat ANXA1. Next,...
Keywords: | Anx1, Anxa1 |
Application: | ELISA |
Species reactivity: | rat |
From 365.00€
*
NEW
![Rat ANXA1 (Annexin A1) ELISA Kit Rat ANXA1 (Annexin A1) ELISA Kit](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number: G-AEFI00955.96
ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Plays important roles in the innate immune response as effector of glucocorticoid-mediated...
Keywords: | Anx1, Anxa1 |
Application: | Sandwich ELISA, Double Antibody |
Species reactivity: | rat |
641.00€
*
![Anxa1, Rat In multiple Geneids, Real Time PCR Primer Set Anxa1, Rat In multiple Geneids, Real Time PCR Primer Set](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number: VRPS-324
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | p35, Anx1, Anxa1, Annexin-1, Annexin I, Annexin A1, Calpactin-2, Calpactin II, Lipocortin I, Chromobindin-9, Phospholipase... |
Application: | RNA quantification |
52.00€
*
![Annexin A1 (ANXA1) Recombinant, Rat Annexin A1 (ANXA1) Recombinant, Rat](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number: 153520.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P07150, Fragment: Met1~Asn346 (Accession No: P07150), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-MAMVSEFLKQ ACYIEKQEQE YVQAVKSYKG GPGSAVSPYP SFNPSSDVAA LHKAIMVKGV DEATIIDILT...
From 399.00€
*