The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat ANXA1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat ANXA1. Next,...

ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Plays important roles in the innate immune response as effector of glucocorticoid-mediated...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P07150, Fragment: Met1~Asn346 (Accession No: P07150), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-MAMVSEFLKQ ACYIEKQEQE YVQAVKSYKG GPGSAVSPYP SFNPSSDVAA LHKAIMVKGV DEATIIDILT...