5 products were found matching "K02970"!
No results were found for the filter!
Anti-MRPS21 (PACO01106)
Item number: G-PACO01106.50
MRPS21 Antibody from Assay Genie with reactivity against Human, Mouse, Rat, Monkey and for use in ELISA, WB, IHC, IF applications. MRPS21 Antibody is Polyclonal and is a IgG isotype antibody from Assay Genie.
| Keywords: | Anti-S21mt, Anti-MRPS21, Anti-MDS016, Anti-RPMS21, Anti-MRP-S21, Anti-28S ribosomal protein S21, mitochondrial,... |
| Application: | ELISA, WB, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat, monkey |
320.00€
*
Anti-MRP-S21
Item number: ELK-ES2847.100
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Keywords: | Anti-S21mt, Anti-MRPS21, Anti-MDS016, Anti-RPMS21, Anti-MRP-S21, Anti-Small ribosomal subunit protein bS21m, Anti-28S... |
| Application: | WB, IHC, IF, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat, monkey |
From 169.00€
*
Anti-MRPS21
Item number: G-PACO10605.50
MRPS21 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, IHC applications. MRPS21 Antibody is a high quality polyclonal antibody for research use only.
| Keywords: | Anti-S21mt, Anti-MRPS21, Anti-MDS016, Anti-RPMS21, Anti-MRP-S21, Anti-28S ribosomal protein S21, mitochondrial,... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
491.00€
*
RpsU, Recombinant, E. coli, aa2-71, GST-Tag (30S...
Item number: 375158.100
Source:, Recombinant protein corresponding to aa2-71 from E. coli RpsU, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.4kD, AA Sequence: PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to...
| Keywords: | rpsU, b3065, 30S ribosomal protein S21, Small ribosomal subunit protein bS21 |
| MW: | 35,4 |
From 636.00€
*
Anti-MRPS21
Item number: ABD-8C16653.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPS21 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Keywords: | Anti-S21mt, Anti-MDS016, Anti-RPMS21, Anti-MRPS21, Anti-MRP-S21, Anti-28S ribosomal protein S21, mitochondrial,... |
| Application: | WB, IHC, IF, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
601.00€
*
