- Search results for K02959
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
10 products were found matching "K02959"!
Close filters
Filter by:
No results were found for the filter!
Item number: E-AB-62435.120
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Keywords: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,... |
Application: | WB |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 198.00€
*
Item number: G-CAB9874.100
Application: | WB |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
From 352.00€
*
Item number: ATA-HPA050081.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 88%
Keywords: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,... |
Application: | WB, IHC, ICC |
Host: | Rabbit |
Species reactivity: | human |
From 335.00€
*
Item number: ATA-HPA054538.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 94% and to rat: 95%
Keywords: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,... |
Application: | WB, IHC |
Host: | Rabbit |
Species reactivity: | human |
From 335.00€
*
Item number: ELK-ES6492.100
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Keywords: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-Small ribosomal subunit protein bS16m, Anti-28S... |
Application: | WB, IHC, IF, ELISA |
Host: | Rabbit |
Species reactivity: | human, mouse |
From 169.00€
*
Item number: ATA-APrEST84675.100
Buffer: PBS and 1M Urea, pH 7.4.
Keywords: | S16mt, RPMS16, MRPS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit... |
Application: | Control antigen |
Expressed in: | E.coli |
Origin: | human |
247.00€
*
Item number: ATA-APrEST84676.100
Buffer: PBS and 1M Urea, pH 7.4.
Keywords: | S16mt, RPMS16, MRPS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit... |
Application: | Control antigen |
Expressed in: | E.coli |
Origin: | human |
247.00€
*
Item number: 374275.100
Source:, Recombinant protein corresponding to aa1-137 from human MRPS16, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.5kD, AA Sequence: VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET, Storage and Stability: May be stored at 4°C...
Keywords: | S16mt, MRPS16, RPMS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit... |
MW: | 38,5 |
From 575.00€
*
Item number: G-CAB9874.20
MRPS16 Polyclonal Antibody (CAB9874) from Antibody Genie, is tested in WB applications.The MRPS16 Polyclonal Antibody (CAB9874) is reactive versus Human, Mouse, Rat samples.
Keywords: | Anti-S16mt, Anti-MRPS16, Anti-RPMS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,... |
Application: | WB, IF |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
149.00€
*
Item number: ABD-8C14035.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPS16 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
Keywords: | Anti-S16mt, Anti-MRPS16, Anti-RPMS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,... |
Application: | WB, IHC, ELISA |
Host: | Rabbit |
Species reactivity: | human, mouse |
601.00€
*