10 products were found matching "K02959"!

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 88%

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 94% and to rat: 95%

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...

Buffer: PBS and 1M Urea, pH 7.4.

Buffer: PBS and 1M Urea, pH 7.4.

Source:, Recombinant protein corresponding to aa1-137 from human MRPS16, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.5kD, AA Sequence: VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET, Storage and Stability: May be stored at 4°C...

MRPS16 Polyclonal Antibody (CAB9874) from Antibody Genie, is tested in WB applications.The MRPS16 Polyclonal Antibody (CAB9874) is reactive versus Human, Mouse, Rat samples.

Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPS16 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...