6 products were found matching "GeneID 401152"!
No results were found for the filter!
Anti-C4orf3
Item number: G-PACO38374.50
C4orf3 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. C4orf3 Antibody is a high quality polyclonal antibody for research use only.
| Keywords: | Anti-C4orf3, Anti-Uncharacterized protein C4orf3, Anti-HCV F-transactivated protein 1, Anti-Hepatitis C virus F... |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
363.00€
*
Anti-C4orf3
Item number: G-PACO38378.50
C4orf3 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB applications. C4orf3 Antibody is a high quality polyclonal antibody for research use only.
| Keywords: | Anti-C4orf3, Anti-Uncharacterized protein C4orf3, Anti-HCV F-transactivated protein 1, Anti-Hepatitis C virus F... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
363.00€
*
Anti-C4orf3
Item number: ATA-HPA026907.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 62% and to rat: 52%
| Keywords: | Anti-C4orf3, Anti-Uncharacterized protein C4orf3, Anti-HCV F-transactivated protein 1, Anti-Hepatitis C virus F... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 335.00€
*
Anti-CD003
Item number: ELK-ES17758.100
Recommended dilutions: IHC-p 1:50-200. Cellular localization: Membrane , Single-pass membrane protein .
| Keywords: | Anti-C4orf3, Anti- C4orf3, Anti-HCV F-transactivated protein 1, Anti-Hepatitis C virus F protein-transactivated protein 1,... |
| Application: | IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 169.00€
*
Uncharacterized Protein C4orf3, Recombinant, Human,...
Item number: 375777.100
Source:, Recombinant protein corresponding to aa1-44 from human C4orf3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.8kD, AA Sequence: MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing...
| Keywords: | C4orf3, Uncharacterized protein C4orf3, HCV F-transactivated protein 1, Hepatitis C virus F protein-transactivated protein 1 |
| MW: | 20,8 |
From 511.00€
*
C4orf3 PrEST Antigen
Item number: ATA-APrEST72150.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | C4orf3, Uncharacterized protein C4orf3, HCV F-transactivated protein 1, Hepatitis C virus F protein-transactivated protein 1 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
247.00€
*