4 products were found matching "A8MUM7"!
No results were found for the filter!
Galectin-16, Human
Item number: CR-C01167-100UG
Sequence: SFLTVPYKLP VSLSVGSCVI IKGTLIDSSI NEPQLQVDFY TEMNEDSEIA FHLRVHLGRR VVMNSREFGI WMLEENLHYV PFEDGKPFDL LNEYEVKVNG EYIYAFVHRI PPSYVKMIQV WRDVSLDSVL with polyhistidine tag at the Nterminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Binds lactose with high affinity....
| Keywords: | Galectin-16 |
| Application: | Active lectin |
| Expressed in: | E.coli |
From 108.00€
*
Human Galectin 16 recombinant protein (His-tagged)
Item number: ARG70468.100
Enables lactose binding activity. Involved in positive regulation of T cell apoptotic process. Predicted to be integral component of membrane.
| Application: | SDS-PAGE |
| Origin: | human |
From 360.00€
*
LGALS16 Human
Item number: ABE-32-6365-10
Source: Escherichia Coli.Sterile Filtered colorless solution.Galectin-16 (LGALS16) binds lactose with high affinity. LGALS16 is a strong inducer of T-cell apoptosis.LGALS16 Human Recombinant produced in E.Coli is a non-glycosylated polypeptide chain containing having a molecular mass of 16kDa.The LGALS16 also...
| Expressed in: | E.coli |
| Origin: | human |
From 438.00€
*
Galectin-16 protein(N-His) (recombinant human)
Item number: E-PKSH034190.100
Sequence: MSFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCHNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNGRR. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Binds lactose with high affinity. Strong...
| Keywords: | Galectin-16, Recombinant Human Galectin-16 protein(N-His) |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 17.42 kD |
From 295.00€
*
