ZNF212, Recombinant, Human, aa1-495, His-SUMO-Tag (Zinc Finger Protein 212)

ZNF212, Recombinant, Human, aa1-495, His-SUMO-Tag (Zinc Finger Protein 212)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
375914.20 20 µg - -

3 - 19 business days*

511.00€
375914.100 100 µg - -

3 - 19 business days*

773.00€
 
May be involved in transcriptional regulation. Protein function: ZNF212 is a factor involved in... more
Product information "ZNF212, Recombinant, Human, aa1-495, His-SUMO-Tag (Zinc Finger Protein 212)"
May be involved in transcriptional regulation. Protein function: ZNF212 is a factor involved in the DDR, HR-mediated repair and ICL repair though direct interaction with TRAIP. Source: Recombinant protein corresponding to aa1-495 from human ZNF212, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~71.4kD, AA Sequence: MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKKMESQAARLQSLEGRTGTAEKKLADCEKMAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPKVSRSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEAELGTEMLGDLEEEGPGGAHPAGGVMIKQELQYTQEGPADLPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQECGQGLKLKKDTSRPYECSECEITFRYKQQLATHLRSHSGWGSCTPEEPEESLRPRPRLKPQTKKAKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQRERGGLALEPGRPNGLL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: ZNF212, ZNFC150, Zinc finger protein 212, Zinc finger protein C2H2-150
Supplier: United States Biological
Supplier-Nr: 375914

Properties

Conjugate: No
MW: 71,4
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ZNF212, Recombinant, Human, aa1-495, His-SUMO-Tag (Zinc Finger Protein 212)"
Write a review
or to review a product.
Viewed