ZMAT5, Recombinant, Human, aa1-170, His-SUMO-Tag (Zinc Finger Matrin-type Protein 5)

Source:, Recombinant protein corresponding to aa1-170 from human ZMAT5, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.0kD, AA Sequence: MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.