ZG16B, Recombinant, Human, aa53-208, His-Tag (Zymogen Granule Protein 16 Homolog B)

ZG16B, Recombinant, Human, aa53-208, His-Tag (Zymogen Granule Protein 16 Homolog B)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
375905.20 20 µg - -

3 - 19 business days*

575.00€
375905.100 100 µg - -

3 - 19 business days*

855.00€
 
Source:|Recombinant protein corresponding to aa53-208 from human ZG16B, fused to His-Tag at... more
Product information "ZG16B, Recombinant, Human, aa53-208, His-Tag (Zymogen Granule Protein 16 Homolog B)"
Source:, Recombinant protein corresponding to aa53-208 from human ZG16B, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~21.2kD, AA Sequence: GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: ZG16B, Zymogen granule protein 16 homolog B
Supplier: United States Biological
Supplier-Nr: 375905

Properties

Conjugate: No
MW: 21,2
Format: Highly Purified

Database Information

UniProt ID : Q96DA0 | Matching products
Gene ID GeneID 124220 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ZG16B, Recombinant, Human, aa53-208, His-Tag (Zymogen Granule Protein 16 Homolog B)"
Write a review
or to review a product.
Viewed