UBE2Q2, Recombinant, Human, aa1-375, His-SUMO-Tag (Ubiquitin-conjugating Enzyme E2 Q2)

UBE2Q2, Recombinant, Human, aa1-375, His-SUMO-Tag (Ubiquitin-conjugating Enzyme E2 Q2)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
375751.20 20 µg - -

3 - 19 business days*

511.00€
375751.100 100 µg - -

3 - 19 business days*

773.00€
 
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In... more
Product information "UBE2Q2, Recombinant, Human, aa1-375, His-SUMO-Tag (Ubiquitin-conjugating Enzyme E2 Q2)"
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Source: Recombinant protein corresponding to aa1-375 from human UBE2Q2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~58.8kD, AA Sequence: MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: UBE2Q2, Ubiquitin-protein ligase Q2, Ubiquitin carrier protein Q2, E2 ubiquitin-conjugating enzyme Q2, Ubiquitin-conjugating enzyme E2 Q2
Supplier: United States Biological
Supplier-Nr: 375751

Properties

Conjugate: No
MW: 58,8
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "UBE2Q2, Recombinant, Human, aa1-375, His-SUMO-Tag (Ubiquitin-conjugating Enzyme E2 Q2)"
Write a review
or to review a product.
Viewed