Tst, Recombinant, Staphylococcus aureus, aa41-234, His-SUMO-Tag (Toxic Shock Syndrome Toxin-1)

Responsible for the symptoms of toxic shock syndrome. Source: Recombinant protein corresponding to aa41-234 from staphylococcus aureus Toxic Shock Syndrome Toxin-1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.9kD, AA Sequence: STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.